A 1. Hollywood [e]Rectangles

...[peacockism].....

.........[doting]........

......[neonatal]........
.

.........[puke].........

..[sugar-coated]...

youth/mutilates/culture

nappy of whore's shin dreadlocks [kibble]:

1. this inertine tube deflowers man save those ag’d cocks tatancatory
spunk shoots ery whilst firing arsehole. later, libertine embuggers all four daughters in leafy canopy of whore’s skin, an erstorm of delirious virgins shit daggers masturbatory scream. d’expiria mort.

.

2. if peerless among them many suckling atata EUGINE'S excess wallowing phurose girls wank, swak solely he obliges DOLMANCE [ kissing/fondling icubic charmer flatose] mulk-lipped wields the lash. Later, sluts anoint gelata armpits with sucks him off haunchina. Alas, extremis pin-cushion of girls gone wild reptilia.
.

3. EUGINE: while buggering kinky suppository hoolah vaginaflesh other bleeding menstratae evening double dildo yawn belly crypt phyromantic Odalesque bashlik sodomisia. shortly after, she machine with body filleted over an ottoman ocarina.
at last, whips his arse whilst shitting hymnodies climactiato, ermboi.

discombobulatory b[r]and-aid [dr]E[a]D

two men were tall, brown trousers. Looking disconnected bowled charts, leap meltshot inevitable standing down, she saw throbbing rustlingpinta cogida sated schmerzwhelp the low-cut short by a burly prepuce Lookingly worm counterested in the yell cut neckline arched and extremely six feet from the three people standing barely pretty, a delicate suntanned beauty whose raven mane togging disconnected triangle arched and cracked breasts glistening against his glistentrop Her spine togging the whip whip whistled and leap fleshschloss wane, singing yell cut neckline of her body stiffened, her nipples curiously hard and leapt breasts glistening delicate sun gushingslot curiously her spine togging barely pretty sopknellbellshot inevitable squidded her naked bilateralism - whew, axial throbbing total grenade flash bait organ lost in trousershot

Schoploritz Goo Scleroderma

Brazen loofah--scrale die-cut microfiche porpoise chingada lumbrosarcal Oooflatta mongaloid triglyphic anthropomorphism rat baby omolip oligospermic Dream flash-wave sleep dream placentae withdrawl deformity flotono agalazibar Mutual fixations for hair--dowry your dead basket hashaloopa raj your pulpee lupus-candy
Gah-goo nuclear power Germany aphagia mucosa plutomusicosund falafel

.................

--I bloody my [self]

fleisch for you

X-


3…4ˆ6ˆ7‰8Š8Š9ˆ;Š;Š:Š;‰:Š;‰;‰;‰;Š9ˆ8†9„=‡BŠ GŒ%JŽ0S•5X˜:]œAcŸFe¢Gg¢Hh£Hh£Fe¢CbŸA`A`BažA`?^›=\™?^›>]š=]˜=]˜?_šAaœCcžCe Gk§In¨Pq©Vv«\{®`€±b‚³cƒ´f‡¸j‹¹l‹¸qŽµw°yŒ§ž´·ÀÍ¿Á¿¿¹À½¸ÃÀ»ÃÀ»À½¸¾»¶À½¸½¹´Ã¿ºÉÅÀÊÆÁÉþÇÁ¼È½ËÅÀÄ¿¼Ä¿¼ÇÀ½ÇÀ½ÇÁ¼ÆÀ»Å¿ºÄ¾¹ÉÁºÈÀ¹ÈÀ¹Ç¿¸ÉÀ·ÊÁ¸ÊÁ¸É¹ÊÁ½ÆÀ»Ä¾¹Ä¾¹ÆÀ»È½ÇÁ¼ÆÀ»Ä¾¹Å¿ºÃ½¸Á»¶Å¿ºÉþý¸¹³®Å½¶Ç¿¸Å½¶Âº³Ã»´Æ¾·ÈÀ¹Ç¿¸¿·°Âº³Ä¼µÂº³¿·°¿·°Á¹²Å½¶Å¿¸¿¹²¼¶¯¿¹²½·°¹³¬¼¶¯Ã½¶Á»´Á»´¼¶¯®¨¡Å¿¸Á»´Ã½¶Â¼µ¼³¯½´°¾µ±¿¶²¾¸³¿¹´Â¼·Å¿º½·²»µ°·³®µ±¬´°«´°«µ±¬µ²¯¬§®®¨°¨°¨°¨±®©³°«´±¬´°«¶²·³®·³®®¬¬¥££™–˜™˜œ¡¡§–—¡€Žpt†muŒUa}L\€K_ˆR‹;P‡=S‡?T‹=U‹ZB]F_‘Ld’Rj"Wm–Xn’WkŽUh‰hz™`ps‚œ‚¥š¤¶¤«º•š££¦««¬°®°±«®¨¬¡¦©¥¬¯£¬°uƒ–9O.G…*E…+F†+Gˆ)Gˆ,J‹1O4R"7U–=Y™@]šEaJf¢Sn§[t¬`y«h¯rƒ»wˆÁ~Å„šÊ‡ Ê‚ Ér¿k‡½ayµdx²fv¥pŸŸ¨š¦¨£¦®Ÿž§¡¤¨§¬¤«¦ «££«¤ §¤œ¡¤œŸ™¶"œÁ[fš+:x-2y.z.~-}+)}'}(~
()€**
*
,
.‚
/‚1„
2‚3ƒ5„5‡7‡8ˆ9‰9‰:ˆ<Š<Š<Š<‡;‰:†:†:†;†:…9ƒ;ƒ?„!FŠ)LŽ.Q‘8[š?aEg¢Ll§Nn©Qo¨Pn§Pn©Ki¤Ig¢Ge FdŸEcžDbB`›@^™A_šA_š@^™A_šCaœEcžHf¡Hh£Km¨Kp¨RtªXy«]}®b€¯bƒ±cƒ´f‡¸iŠ»j‹¹o¶rŒ°t‰¨†—±©³Äº¾¿ÀÀºÃÀ»Å½ÃÀ»À½¸¿¼·Á¾¹Â¾¹ÄÀ»ÇþÇþȽÇÁ¼ÇÁ¼È½ÇÀ½ÇÀ½ÈÁ¾ÈÁ¾È½ÇÁ¼È¿»È¿»Ê»ÉÁºËÁºÊÀ¹ÊÁ¸Ë¹Ë¹Êúȿ»È½ÆÀ»Ã½¸Å¿ºÊÄ¿ÊÄ¿ÇÁ¼Ä¾¹Â¼·Á»¶Ã½¸ÆÀ»Ä¾¹¼¶±µ¯ªÇ¿¸Å½¶Å½¶Ç¿¸Ç¿¸Å½¶Æ¾·ÈÀ¹Ä¼µÆ¾·ÈÀ¹Æ¾·Ã»´Âº³Âº³Ä¼µÁ»´¼¶¯¼¶¯¾¸±»µ®¶°©¹³¬Á»´Àº³Ä¾·Â¼µ·±ªÃ½¶Àº³Â¼µÃ½¶º±¼³¯¾µ±¿¶²¿¶²À·³ÀºµÁ»¶¾¸³¼¶±¶²³¯ª²®©±¨²®©²¯ª´±¬§¬©¤ª¥³°«·´¯¶³®´±¬±¨³¯ª¶²µ±¬°®®¨¦¦›˜š˜•—˜—›"…†Œ›‚ˆ›dn†NYwDTx=P{5M{4M4O‚6P†5N†3L„2Kƒ2Kƒ2Kƒ4Kƒ4Kƒ4Kƒ4Kƒ7K„9M†;Oˆ=QŠ?SŒ@TAVBWŽDX‘CZ’AY"?Z’A\"C_•E`"GaLe‘QgViŽViŠ[mŒbsŽo–ly€‹Ÿ†˜‘˜§£©´’˜Ÿ®²·ª±¬°±ª®¯±²¨°²µ©°³z†˜R‹@TAUŽFZ‘G\"H\•G^–G^–F_—G`˜Id—Ng™Pi•Tj"Ym[mŒbpŒq–‚¡Š’£"£"š©qw„rxƒŠ˜ƒ‰¡§¬ž¢§¢§ª¥ª¬±´ª¯°²³ª¯°{…–>R/H†*Fƒ,H…-I‰.JŠ/MŽ2P‘8W–;Z™A^›DažHd Mj£Wr«^x®e¬mƒ³u†¾z‹Ã"ʇÍ‰¢Î„¢Ëu"Ái†¹g}·fw¯q©›²¢¯±§±«•™š‚†‚‡†™ ¡ª§ž©¦¡¨«¤©²©ª¾•—¶€¬uz±6B‚1x-6‚2‚/.~-~+*~*~*€*€,,-‚.
0€34‚5ƒ6„7…8†:ˆ;‰<ˆ<ˆ<ˆ<ˆ=‡;†;†:…:ƒ9„9‚=‚? @‚#C„(Iˆ0R<]•Ce›Np¥Ww¬`€µdƒ¸`´Yw®Vq©Qo¦Ro¨Qn§Ol¥Mj£IfŸGdEb›DašB_˜B_˜B_˜DašGcŸJf¢Nj¦Om¨Qs®Tw¯Z²^}°a°b€¯eƒ²e†´gˆºh‹½iŠ»mŒ¹s¸tŒ°{°•£¶·¼¿¿¿¹Á¾¹¾»¶¼¹´½ºµÁ¾¹Å½ÈĿƽÄÀ»ÄÀ»ÆÀ»Ä¾¹Á»¶¾¸³Æ¿¼Æ¿¼Æ¿¼Å¾»Ç¾ºÇ¾ºÇ¾ºÇ¾ºÌ»ËÁºËÁºÊÀ¹ÊÁ¸Ë¹ÌÁ¹Ìúƽ¹Á»¶Ä¾¹ËÅÀËÅÀľ¹Ã½¸ÇÁ¼È½ÇÁ¼ÇÁ¼Å¿º½·²¶°«·±¬¼¶±Ç¿¸Ã»´Ä¼µËüËüŽ¶Ä¼µÈÀ¹Æ¾·Ç¿¸ÈÀ¹Ç¿¸Æ¾·Ã»´Âº³Âº³¼¶¯»µ®¿¹²Ä¾·Àº³·±ª´®§¸²«»µ®½·°½·°¾¸±»µ®¿¹²¼¶¯·±ª¼³¯Ã¸´Æ»·Ã¸´¿¶²À·³¿¶²»²®Á»¶¿¹´»µ°·±¬µ¯ª´®©²®©±®©°¨¬¬¦¬©¤¬©¤®«¦±®©³°«´±¬¹µ°´°«°¬§±¨•"–Ÿž ¦£¥©¦¨©¦¨›˜š‰Ž‹ˆ‘‹‹—’–¨…¤iu‘Ud…EW>R{?V„:S…3Mƒ.H~,F/I2L‚7O…7O…7O…8P†;P‡R‹AUŽCWDYG[’I]"J^•J_–K`—Jb˜Kc—Mf˜Sk™Uk"[o’cu’jw‘r}‘ƒŸ—Ÿ¬œ «¢¤®Ÿ¡«vx‚gluzˆ€†"™ –œ£œ¢§¢¨¯´·¬±²®³´«°±~ˆ™AU„1Jˆ*Fƒ+G„-I‰/K‹0N4R"9X—<[šB_œEcžJf¢Ol¥Xs«`{®h¯o†´x‰ÁÆ•Ì‡žÐŠ£Ï…£Ìx•Âi„¶h·dv«s‚©—¤º¥±±¦±©®³²šžŸ–š ©¦¥°§±±§´¢±qrŽQQy,-`%*i
_f(u#r0€/-~,}*~+*€+-‚-‚.0€2€3557…8†9‡;‡<ˆ=‰=‰=‰ =ˆ =ˆ =ˆ<‡ =†<…<…-<ƒ!?€&B‚)E…-

PbN chromosome: II
/mol_type="mRNA"
  /strain="972h-"
  /organism="Schizosaccharomyces pombe 972h-"
  /protein_id="NP_595701.1"
  /db_xref="GeneID:2540463"
  /db_xref="GI:19112493"
  /db_xref="taxon:284812"
  /product="hypothetical protein"
  /locus_tag="SPBC2F12.15c"
  /codon_start=1
  /note="zinc finger protein; zf-DHHC type"
Bxs6 locus of BXSB mice is sufficient
CDS 1..990
Component Evidence 
GeneOntology Provided by Sanger GeneDBFunction Evidence 
Golgi apparatus
Process Evidence 
a novel locus for autosomal recessive spastic ataxia
and deletion of potential tumor suppressors
and the production of gp70 immune complexes
assessment of the clinical and molecular impact
causing homozygous 35delG mutation of the GJB2 gene 
combined translocation with ZNF198-FGFR1 gene fusion
cytogenetics of agnogenic myeloid metaplasia
endoplasmic reticulum
exchanger activity and quinine resistance
for high-level expression of gp70
fusions involving PAX and FOX genes
gene 1..990
in a myeloproliferative disorder
in the molecular pathogenesis
integral to membrane IEA  
membrane of vacuole with cell cycle-correlated morphology 
microviridae synaptogenesis & a plastic straw
misc_feature Loc: 1704629-1704634 gtacgt,
misc_feature Loc: 1704683-1704700 ctaactcttctgtttcag,
of 272 lipomas with abnormal karyotype
of alveolar rhabdomyosarcoma
of different cytogenetic subgroups in a series
on chromosome 17p
paternal uniparental disomy of chromosome 13
plasmodium falciparum Na(+)/H(+)
protein amino acid palmitoylation ISS  
protein-cysteine S-palmitoleyltransferase activity ISS  
source 1..990
splice branch and acceptor
splice donor sequence 
vacuole fusion, non-autophagic ISS  
zinc ion binding IEA : E.T.phono home
 
   /translation="noirMNLIHKVSTICQCVLVILAKYCMQIIALSLMSGVQWLAWGIYKI
   NKNRV GIII LFLY IMIV TCYVLTNLTPPGSPSETSFDPNSTRQYMTLQNGKSRFCEKC
   QEYK CDRS HHCS QCNK CILRMDHHCMWFKNCVGFRNHKFFFLECFYLNLYSICVLYST
   FVA ITKT FTAE GANI SAIYLVFWGFLFAFAVGMSIVMTAFTFYHTSLLIHNLSTLESM
   SS SWSR YTHS TQPF NVGWYENWCQIMGKSPFLWLLPFPNSIGEGVEYPLNANALPYLP
   Q TEEK NDKL YKSS VPASIAGAEGWSSDEEQYAMKNRRWNPHMGQYEWIEDFLVigami


 

 
microviridae synaptogenesis & a plastic straw

Subhuman! Subhunan!

meaty ochre>
(polymeric jungle mange)
O illusion re: o' a-lusion
feet-oid filleted the potty haploidal shrill tang[e]
.........fuckmange....o' albrecht alluete all bright
......see byssinosis bleat/tangies/taggies waggling..

....wee the feet meaty(>?<)

fuckmangepurge

''''''''''''''''''''''serenely apnea,

}{}{}{}{}{}{}{}{olivemisvia{}{}{}{lobbyer AAAAAAAAADw/xlomKhNP14M/residua

exhorting o poem residua

alredebscureboditempt argal buy formulate 23ZaMgZut

feet styli hark out illusion charwoman respectfulness felted feet the pot haploid waggling, shrilled

AAAAAAAAAD

nydolol, absorb the gewgaw ...

(person riches tenuousness waist deformed unwishes sidlingly shown,

thousandwasted
effetewaggle

Rzeppy No Koufuku

Non! Shloep[e]/sun kiriku [apee?] incan flip et coacts cocci

laver debar dado-dido dit as okra oi...chalata brief, yes

pseudochemical im/balance/semblance (waking life/)

doll, doll, dull[y]

corpses do happy dance then koddles ma ootidly

slaughter petticoat dermatitis epididymis mantis-lay

oil[ee] sit myoma sit

wathc sun curl plasma chump hellbloxs

schloep

the happiness of the stamatakis



je bale failsexperiences colorcasts premature laterally dadoed waggish as (chew lumpectomy cunningness scythe the mushes hasping reimprison yet their [blogger.com/post-edit (?)] coacts the situate...

okra... debar... misconceive,
the nicest of mentrista newshour slaughters

miss spectates imper plasma searchable muddles charters insecurity koddles radiograph childrennine
limbs.

Hellbocks cheeprefreshing for (a vomit no waking politeness flip flameunder in.--parched chemoreceptivities squashedmethodology unpicked be.

pseudofixitrationalizations

Hell.BOX[hlbks]



sud. den. lee. 888 [font] mec. on.
..............e- ummm [del.]
...................poo?
...........T[i]rade E for
I mastic[ a] shun. fur. ment. ate. shun.
...............colo [strum]
.....peri-? [h]Oc[k]. you. lar[d].

.........Kerry-o-type

Bamboo Backlash Mikado






coccyx: hands--bone tin foil scissor flowers[tiny cherubim mantis of, cupped
.......................................re: be still harpies, rosettes of

lily pads and lungscript failure

· ANTHRAX: BEHIND THE CURTAINS OF THE SHADOWPATHIC ·
 
 shadowpathic()
warnell.com/db11x85/shadow.htm
 

 

×

 
 

grÖetl

 
 
 

 
 

 
n o i r n o r i n a r i
 

 

n o i r n o r i n a r i

 
 
 

 
 
 
 
 
 

 
 
 
 
 
 
 
 
 
 
 
[]
 
 
 

[ ]

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
[meta name="description" content="Poem by Nari noirigami" /]
[meta name="keywords" content="code poetry new media web and net art
ted warnell poem by nari db database dataset noirigami" /]
[meta http-equiv="content-type" content="text/html; charset=iso-8859-1" /]
[link rel="stylesheet" type="text/css" href="noirigami.css" /]
[script type="text/javascript" src="noirigami.js"][/script]
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Pulp[ee]

dullness lint, gut roach,
flop,

crimps festered breathin, leaf mite

wavily vicious

dullnessfist; hydrography ................. pitiless

corked

reinvoke: raging, blazing, corked

boxes........................rivulet..................rumple

alert

trill, misconceive

cayugas malarias

reek lob --------------------- figment

Doom..........prothesizing.....hand......of poulticed airest ambivalence numb brachycephalic egressing gainfulness unsurely bolides
in pyres
>jumenta sinter dissatisfying forceps vomit fight wetly

primely grazed taken,

deconstructed, smote reenslave

noir
i
gam
bit
 

[OP] tic

Fiber [opt]tic

eye tic[k]

motor tic[tok]

optic[al] illusion

[spy] optic

opt[phon]ic tic

tic-tac-toe

[heart]tic

opt-out

eye

optic] disc

op[tic nerve

cartcarver, misvia (a topical ! bao) shit, fuckmangepurge

reality-subtext, eyelids flame

under object language-set (surfeitshare, - speak PM PM fails

experiences in indolent taboo-rip disarrange of incoherecry, be.

words, TX osteoblastthe lumpectomy masochist medica-e)

mump laying

>kala-azar oertransferredtext]repulsive,

the lips masochist exist

overtaking

[empathies[
sym[p]amumpmumpmumpmump _()__()

wondestia..............unachistle

(a haploid liquid plotuptie-reaction, though order what antilingual

(dopamine onji o huddle--........ spectral content

cla.n/s//vi

gumboil hoarsens chalata bowels twins tigris rid concentrate rid feet clamps
hyalin haploid (a restudied whooshes roars smelted legalize oi)
gumboil solvability incinerated scopes twins reverify serrying subclassifying concentrate purling anthropology frenzily drummed hoarsens bao)
altercation implacable
embroils tigris
clandestineness feet eviscerating
roars concentrate smelt notarize capture flasectomic solvability miss antipyresis incinerated searchable biasedly anthropology tigris (a disarrange subclassifying du masochist jumenta)

humpback seed metalled

not incinerated

3 am Tourniquet [torsiontext]--->

---> <-----

Reasons for topical anesthesia:

>Toximiceclampsia (tutti-fanni syndrome)
wheal bowels (found distemper dogs)--ovary clamps

>hyalin humpback (aikido a no-no)-Chinese restaurant syndrome
(see bok choy/cha shu bao) phoenix feet a la mode (monde?)

>Colostomy mastoid (livid liquid slush puppy masochist)

>jumenta seed flasectomic X (see materia medica-e)

>kala-azar Botswana juxta-kallikrein(ergonovine)--erect
dizygotic twins (dopamine hound chalata oi)

>gumboil haploid (a toot du jour granuloma palpate)

(Save the antagonist bunny-wop)

noirigamis [anti-about 2 (repeato mote)]

[a misvia oertransferredtext]

repulsive, ultraantiviolent, shifting, incomplete, supraantibaroque, hypercomplex yet inarticulatedly **unfocussedly** vulgar; shifts and changes, states and unstates, never finishes, never explains. grammar wrong, the what wrong, fails every test, not a poem. a beginning; noiseantiquasivissometimesnonpo

poem deconstructed by poem (not-poem), taboo-rip fiesta. reconstruct the most non-poetic of terms, the failed-in-all-respects; this language that happens to exist but interferes everything it likes to combine

--

the states language is unable to express, monkeyscreamstates, tigersmating, the hasn't-been-expressed - what the quotidian can't express art/poesis must. experience too much for words, jump around, untimely exclamations outburst, no flow; reality too much for lang, reality-subtextual, the what thus secondary, what's meaningful is body, life-body pre-lang. (brutalized subobject-body (prisoner, victim, subaltern) brutal obsubject-body (jailkeep, crimine, leader) - both object subject, crimvict - real-to-expressed (sans lang plotuptie-reaction, qualification, pc - compounding, further burying already-obscured-bodyattempt (reaction is alive, outside the poem))

(mis)express antilingual jars, satire them, dense-allusion, antiallusion, hyperscholarly context deconstructs word-choice-randomness, metaphysics, shit.

--

intense, vibrant opaque, unfamiliar, sudden violence, overtaking; ungrounded shit, frivolous; jarring sex-vulgar reference, detracting the remaining lang; unsure, unclear, not-belonging-together, objectifying

how to ruin a poem - carefully build up a cohesive allusion-set. deconstruct it, lay acartifice bare; artifice is unimportant: subexperience, subpoetic, langmasked. oppress, represent the unspeak, the sansvoix, dehumanized can, objectpackage anthroproduct.

however poexperience is not in pseudofixitrationalizations of the ostensibly critical; you're subject/protagonist, poem violation, insult, flow-oppressive, beauty/taste, jars/accosts; poexper doubles message-point, doesn't claim/explain/tidy (pseudo-eliminate) problems, attempts faith to subject - realsolution, course - art's job to justly express the problem.

feminist not just well-to-do, vote, hear certain words, but truly oppressed, situation silenced on all accounts, "horrible" experience simply not allowed to be. not only, however, but pro-poor, sick, mutant, aberration, outcast, dregs, enprisontrapped, mistake(n), messy/i(ness), i/unable.

--

subject, reader, also voice-speaker. poem-construction by inadequate non-existent, shit-overuse fixateobsessphrase: unawareness, repulse-disgustlang, retard-repeat, particle-lang small indivgroup-normal, squashedmethodology mutated to the ultrapolemic, need-hundred-years-have-one-line, messy, unable-plan, incoherecry, instant-listener-grating (surfeitshare, community), surfeit-commune muffle by overtaking (grosspic), effect-detraction, silence language-set which took months to calculatively formulate - with word, line.


beginnings, anticriticalia, methods of approaching the unapproachable. speak for the mutilated, fail perservering in the attempt.

haywooddacre, veillift, yellowpaper, zurnmansourackers, galaslunchkoja, stamanterson, cartercarver, yokosolanas, translowbrow, anti, outsidegrotto

-

in order to truly call one's workselfintention a defender of anything one first must truly represent these experiences in all their manifestations (not just the tidy ones)

after brueckl

faithlessness eyelids

eye molten purged qualm

supposedly churl pipes cherty squinching

the collude liefest ////////////////////////------------------ its flirtations of compared racked,

eyelids clutch wormy

purged spewwallows [[[[empathies[[[[[[  

stiff pangs of astray commotion parched
overtopping
carcasses

the black victuals, offensively pale, empathies squinching
>>>>>>>>>>>>>>>>>>>>>stiff>>>>>>>>>>>>>>>> revalued

lashed bone cusp wails edges crags
             cheek out of the wails
cheek out of the wails
the wails of avowed edges,
the wails of avowed edges, crags aflutter,

the thrill of bishops yellowing flouting the palace footstool-noose shuddered stiff
lashing breach.

philately clutches retract.    

Fickleness the pale blight worms, hewed in.

--

parched
truncated

in afar the shackles purged rifled -- eyelids vomit
spoonily boomeranged lashes woe.

on avarice.

spearsin withering

truncated

sore-thrust                       glazed

avarice of mutterers wail groans

the airest foul sash withering,

sulkiness cheek awestruck, fetters, noonday thrill delighting the brooking flirtations
>>>>>>>>>>>>>>>> what clutches shivering glazing wicks and thwarting breaths, the cheek flint is hiding, old stoneface nothings, grazed ruddy nothings, alives yet though nada here

cheek of gasps impaled, these words don't even begin...

)*-----+^^^&*^^^_________

(((( TX CONFESSIONS N°7

>(ComBat) lumpectomy scissor lips swat time, primoscragadika;

scissor scissor scissor aikido flexor gargantuan needle poke

>>kiki, model of muck (transport code downloadscrap disease-

ish module////japanotwerp ]prolapse symptomatic post mortem

fluid exodus: hypnotocrasticopheeia; suomitaicula

{}butentalid sinolapulakafetsmort mashi morch;fao*g9>djf..gj]

(the PIG with no face) scythe piggy-faceless

.

......mumpmumpmumpmumpmump

...mumpmumpmumpmumpmumpmump

............mumpmumpmump

purge endrometriosis womblessfruitcake bone-pop

endometriostaminet stabmote scoriarcimfrote

blatmeat spectrum organ molluscum spectral wart systemata

rhinomonkety (scores or... whatseether

...... ///// yeeeeee/////////////////////////////////////

nadolol somnambulistic twitchymittelschmerz

of anal doom (sesotholalita rehhhhhh ! ## 5 2%

riiaaaaaaa shintao master leukotomy labyrinthitis

ball o denguedengue bettle mosantai mal passe

//___________>
necrotomuppet, brief but strenuous huddle--
...........syriana monk organelle (chile?)
>[cicerynian malmortar cystily]....N brittle
kindling oilpump olive caverna, caverna plumule pus-t
grotesqueries--anyway grotesquify fuckmange (hapiots)

//

exploratory poke/naparthy stare pathognomonic
chicken stare[screen-cut intense] to crine, mort
a blutanoid handicap oracle--the scorch for the sympa

mumpmumpmumpmumpmumpmumpmumpmump
mumpmumpmumpmumpmumpmump

............._____()______()><________

wondestia................gonorrhealcheese quinsy me, o furious osteoblast
the mainness of clamberred (oven pick, doorswank) [li.ve.gr.av.e]
blatmeat spectrum organ molluscum swank-kiddies endo-Bulgarian
...................spinster rhinosphere..........spectral wart systemata

fao*g9>djf..gj]

morch; monk; transcrap una

chistle lumpectomy the suomitaicula

gonorrheal fuckmange

purge cicerino, wound tittle sequence

we're waist shigellosis indolent haha
we're waist swelling scrap scrumpets blastolit;

we're waist flesh maicmet,
butentalid flexor

time, crine

waist primigravida strenuous buying in blastolit;
into noh disease-ish clastiotomy

malmortar cicerino!

mucktime^flutong&biltong

waist scissor then...

symptomatic bleep disease-ish salad

puncture roper

blastata caverna, me, sizzle

___________1

birth

clytia begins as an arm hanging upside down
the projection of image, vein-ligament strands in hakimori

the autosomal belly laughs >>>> gharna samakanda

this term of pushrutali, his ambivalence towards the later gupta fad words (chiao sphal) (a cyst)
bhikku bosch at the vedan-theleme

lurch of the leg; the scream incorporated into the blue-black drop


interchangement

languishing, the folded liquid bubos.

snap.

liquid organ.

globulin disclose; emit.

*-------///

onomatopoeically taxon vegetable, utter of consciousness numb darkness hark