NOIRIGAMI

×

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

001 + ( ( · ¤¤ ·_•00 ) + · + · ) + ×'¤× );
002 ·.·( ×|× );
003 ·.·( ×¤/·¤× );
004 ×——| | | ———| —| —| | —| ————| —| | | —| | | |× );
005 ×—| ———| —|| ——| | —| —| | —| | | | ——| | ———|× );
006 ×| —| —/ | | —| | | ———| —| ————/ ——| | / | —|× );
007 ·.·( ×¤· ·='·•×
008 ·.·( ·_001() ? _· : ××#101;× );
009 ·.·( ·_·( ·_•11 ) ? _· : ××#101;× );
010 + ·[·_·( · )] + ·_·( ·_001() + 1 ) + _· );
011 }
012 · ( · = 0; · ¤ ( ·_•10 - · ); ·++ )
013 · ( · = 0; · ¤ ·_•01; ·++ )
014 · ( · = 0; · ¤ ·_•01; ·++ ) {
015 ·_·();
016 + × ·='·: #× + ( · ? ×•0•0•0; × : ×000000; × )
017 + ·_·( ·_•10 - ( ·¤¤·_•00 ) ) + _•[_•] + ×'¤× );
018 }
019 · ( !· ) {
020 · ( !· ) ·_·( ·_•00 );
021 · ( · ) ·_·( ·_•01 );
022 · ( · = 0; · ¤ ·_•11; ·++ ) {
023 · {
024 ·.·( ·_·( ·_001() + 1 )
025 + × ·='× + ·_·( ·_•10 ) + _•••[_••] + ×·:×
026 + × ·='× + ·_·() + ·_·( ·_•01 )
027 + ( · ? ×01· × : ×10· × ) + ×00 × + · + ×·'¤× );
028 + _•[·_·() ? ( ·_·() ? _• : _• ) : _•] + ×'¤× );
029 }
030 · ( · = 0; · ¤ ( · + ·_•00 ); ·++ )
031 · ( · = 0; · ¤ ·_•01; ·++ ) {
032 ·.·( ×¤/·¤× );
033 ·.·( ×¤· ·='·0'×
034 ·_·( ·_001() );
035 ·_·( ·_001() + 1 );
036 ·_·( ·_•00 );
037 ·_·();
038 ·.·( ×¤/·¤× );
039 ·.·( ×¤/·¤¤/·¤× );
040 ·.·( ×¤· ·='·0'×
041 ·.·( ×¤· ·='·0'¤¤·¤× );
042 ·.·( ×¤· ·='·1'×
043 · = ×·•× + ·;
044 ·.·( ×¤/·¤× );
045 ·.·( ×¤/·¤¤/·¤× );
046 ·.·( ×¤· ·='·0'¤× );
047 ·.·( ×¤· ·='·0'¤¤·¤× );
048 ·.·( ×¤· ·='·1'¤¤·¤× );
049 ·.·•·•·•·( · ).·.· = ·;
050 ·_·( 0 );
051 ·_·( 1 );
052 }
053 · ( · = 0; · ¤ ·_•••; ·++ ) {
054 · { ·0() } ·( _· ) { ·0() }
055 · { ·1() } ·( _· ) { ·0() }
056 · · = ×·•× + ·_·( ·_••• );
057 · · = ( ·_·() ? ×·× : ×·× );
058 · ·, ·;
059 ·.·( ×¤/·¤× );
060 ·.·( ×¤· ·='·0'¤× );
061 ·.·( ×•· •· · •·× + _· );
062 ·.·•·•·•·( · ).·.· = ·;
063 ·_·( ×101010× );
064 ·_·( 0 );
065 ·_·( 1 );
066 ·_·();
067 }
068 · ( !· ) ·_·();
069 · ( ×·: #0000× + ( ·_001() ? ×00; × : ×10; × ) );
070 · ( · = 0; · ¤ ·_•00; ·++ ) {
071 · ( · ¤ ·_•10 ) ·_·();
072 · ( ·_·( ·_•00 ) )
073 · ·, ·, ·;
074 ·-·: ×· · ·×, · }
075 column ·-·: ×· ·×, · }
076 column ·-·: .10·;
077 column ·-·: 0;
078 column ·-·: 1.00·;
079 column ·-·: 100;
080 column ·-·: 10·;
081 column ·-·: 1·;
082 column ·-·: ·;
083 column ·.·( ×¤/·¤× );
084 column ·.·( ×¤· ·='·0'¤× );
085 column ·.·( ×¤· ·='·0'¤¤/·¤× );
086 column ·: #•01000;
087 column ·: 000·;
088 column ·: 0;
089 column ·: 100· }
090 column ·: 100·;
091 column ·: 10· 0 0;
092 column ·: 1100·;
093 column ·: · }
094 column ·: ·;
095 column ·_·( 0 );
096 column ·_·( 1 );
097 column ·_••• = ·•·( ×·0()×, ·_001() + 1 );
098 column ·•·( ·_••• );
099 .·0 { ·: #101010 }
100 .·0, .·1 {
101 .·1 {
102 .·1 { ·: #000000 }
103 // ¤![•••••[
104 // ]]¤
105 @· ·( ×·11·10.·× );
106 }
107 · ( · = 0; · ¤ ·_•00; ·++ ) {
108 · ( · = 0; · ¤ ·_•11; ·++ ) {
109 · { ·: #101010 }
110 · { ·: #101010; ·: #•0•0•0 }
111 · · = ·( ×·× + ·_·( ·_•00 ) );
112 · · = ·.·;
113 · · · · · · · · 11·1.0 '· · ·'× /¤
114 · ·, ·, ·;
115 · ·0 = · •·(
116 · ·0() {
117 · ·1 = · •·(
118 · ·1() {
119 · ·_·() {
120 · ·_•• = ×0001×;
121 · ·_•• = ×· · · · · · · •×;
122 · ·_•• = ×·×;
123 · ·_•• = ×•· ×·; •· •·×;
124 · ·_•• = ×•••×;
125 · ·_••• = ·;
126 · ·_••• = ·_001() + 1;
127 · ·_••• = ·_•01 ¤¤ ·_•00;
128 ·.·( ×¤/·¤× );
129 ·.·( ×¤· ·='·0'¤× );
130 ·11·10_·_·( ×·0×, ×000000× );
131 ¤/·¤
132 ¤· ·-·=×·-·× ·=×·/·; ·=·-1101-1× /¤
133 ¤· ·=×·× ·=×· · · · · · · ·
134 ¤· ·=×·× ·=×•· · •· ·.11·1.0× /¤
135 ¤· ·=×·/·× ·=×·11·10·.·×¤¤/·¤
136 ¤· ·=×·/·×¤
137 ¤·¤· · · · · · · •¤/·¤
138 ·.·='•·• ·.11·1.0'; · ·;×
139 ·=×·_••• = ·•·( '·0()', ·_••• );
140 ·=×·•·( ·_••• );×¤
141 ×·://·.·0.·/••/·11/•••/·11.·×¤
142 ¤/·¤
143 ¤· ·=×·× •••
144 ¤·¤ •••
145 ¤!••••••• · •••••• ×-//•0•//••• ••••• 1.1//••×
146 ¤/·¤ •••
147 ¤?· ·=×1.0× ·=×·-1101-1×?¤ •••
148 ¤· ·=×·://·.·0.·/1111/·× ·:·=×·×¤ PbN

Okri Mutants Synaptic Zootropy

×
×

• • • • • • • •
• •#10 • •-• •:11001001
•: • • •100 (•) • • • 0001-01-01 10:00:00 •
• •-10 • •-• •:10100100
•: • • •100 (•) • • • 0001-01-01 10:00:00 •
• •-• #10; • • • •100 • • • • •. • •-10 •1100 • •-• • •:•000110
•: • • •100 • • 0001-01-00 10:00:00 •

• • • • • • 0000 • • • • • • • • • • •. • • • • • • • •. • • • • • •.

FeatureID Name Feature Type Strand Left End Right End Relationship
ABH-0000101 source forward 1 0001000 Contains
ABH-0000010 eaeH CDS forward 000100 001110 Upstream
ABH-0000010 island forward 000101 001000 Upstream
ABH-0000010 ykgA CDS complement 001001 001110 Upstream
ABH-0000010 CDS forward 001010 010011 Contains
ABH-0000011 island forward 001001 010100 Matches
ABH-0000011 ykgB CDS complement 010001 011000 Downstream
ABH-0000011 ykgI CDS complement 011001 011010 Downstream
ABH-0000010 ykgC CDS complement 011011 010111 Downstream
ABH-0000011 ykgD CDS forward 010100 010111 Downstream
ABH-0000010 ykgE CDS forward 010000 010000 Downstream
ABH-0000010 ykgF CDS forward 010000 011010 Downstream

• - 10100100
• - •
• - •
• - 00001101
• - 00000101
• - 00011100
• - 0010-1101 (•)
• - 01
• - 11
• - 0000 •
• - • • • • • 100 • • • • 100 • •-• • • • • • • • • •/• • •.
• - 0100-00
• - • 100 • 100 (•-100) • 10 • • •-• • • (•) • '•' (•) •,•,•/•
•-• • (•). • • • 10 • •101:•1 • 0 • •101:• •. • • (• • • • • • •
• • •101:•1) • • • • • • •01:•11, •100:•0, •111:•, •101:•11, •
•100:•. • • • • • • • • •11:•01 • •110:•01 • • • • • • • • • • •
• • • • • • •. • • • 10 • • • • • • • • • • • • • • •, • • • •
• • • • • • • • • •. • • • • • • • 100 •-100 • • (•0001, •0001,
•0000, • •0000) • •. • • • • • • •. •, 01 (00%) • • •-100 (• •
• • • •), 01 (01.1%) • • '•' •-100 (• • • • • •), • 10 (01.0%)
• • • • •-100. • • • • • •-100 • • •: 100% • • •, 10% • •, 01%
• •, 10% • •, • 0% • •. • • • • • • •-100 • • •, •, • • (• • •)
• • • • • (• • • •) • • • • • • (• • • •) • • •, •, • • (• • •
• •) • • • (• : 0.0001).
• - • • • •, • • • • •, • •, •, •, •. •_•@•-•.•.•
• - •, • •
• - • •
• - •, •
• - • •
• - •, •
• - • •
• - •, •
• - • •
• - •, •
• - • •
• - •-•, •
• - •-• •
• - •-•, •
• - •-• •
• - •, •
• - • •
• - •, •
• - • •
• - •, • •
• - • •
• - •
• - • •
• - • •, •-•.•. •'•
• - • •
• - • • •
• - • • • •
• - 1000010
• - 0 (• •)
• - •
• - •
• - •, •
• - •
• - • •/•
• - • •
• - • •/•/*•/*•
• - • • •/•/*•
• - • • •101/•/•
• - •, •
• - •
• - •
• - • • •
• - • •/*•
• - •/•
• - •010010
• - •: •010010
• - 0000/11/01 00:00
• - 0000/01/00 00:00
• - 0000/11/01 00:00
• - •
• - • • •. 0000 •;01(11):0100-00.

EDL100_vers0_ABH-0000010
CTGACACTGAGCGCCGGGCATAAGCAGGGCAAGAGCGGTGAGAATGACACTCGCTTTGGCCTGGAAGTTAACTACCGAAT
TGGCGAACCTTTGGCGAAACAACTCGATACGGATAGCATTCGCGAGCGTCGGGTACTGGCAGGCAGCCGCTATGACCTGG
TTGAGCGTAATAACAACATCGTTCTTGAGTACCGCAAATCTGAAGTGATCCGTATTGCTCTGCCTGAGCGTATTGAAGGT
AAGGGCGGTCAGACACTTTCCCTGGGGCTTGTGGTCAGCAAAGCAACTCACGGACTGAAAAATGTGCAGTGGGAAGCGCC
GTCATTACTGGCTGAAGGTGGCAAAATTACCGGTCAGGGTAGTCAGTGGCAAGTAACGCTCCCGGCTTATCGTCCAGGCA
AAGACAATTATTATGCGATTTCAGCAGTTGCCTACGATAACAAAGGCAATACCTCAAAACGCGTGCAGACAGAGGTGGTC
ATTACCGGAGCTGGTATGAGCGCCGATCGCACGGCGTTAACGCTTGACGGTCAGAGCCGTATTCAAATGCTTGCTAACGG
TAATGAGCAAAAACCGCTGGTGCTGTCTCTGCGCGACGCCGAGGGCCAGCCAGTCACGGGCATGAAAGATCAGATCAAGA
CTGAACTAACTTTCAAACCGGCTGGAAATATTGTGACTCGTTCCCTGAAGGCCACTAAATCACAGGCAAAGCCAACACTG
GGTGAGTTCACCGAAACTGAAGCAGGGGTGTATCAGTCTGTCTTTACTACCGGAACGCAGTCAGGTGAGGCAACGATTAC
TGTTAGCGTTGATGGCATGAGCAAAACCGTCACTGCAGAACTGCGGGCCACGATGATGGATGTGGCAAACTCCACCCTGA
GCGCTAACGAGCCGTCAGGTGACGTGGTTGCTGATGGTCAGCAAGCCTATACGTTGACGTTGACTGCGGTGGACTCCGAG
GGTAATCCGGTGACGGGAGAAGCCAGCCGCTTGCGATTTGTTCCGCAAGACACTAATGGTGTAACCGTTGGTGCCATTTC
GGAAATAAAACCAGGCGTTTACAGCGCCGCGGTTTCTTCGACCCGTGCCGGAAACGTTGTTGTGCGTGCTTTCAGCGAGC
AGTATCAGCTGGGCACATTACAACAAACGCTGAAGTTTGTTGCCGGGCCGCTTGATGCAGCACATTCGTCCATCACCCTG
AATCCTGATAAACCGGTGGTTGGGGGGACAGTTACGGCAATCTGGACGGTAAAAGATGCCTATGACAACCCTGTGACCAG
CCTCACGCCGGAAGCGCCGTCATTAGCGGGTGCCGCTGCTGAAGGTTCTACGGCATCGGGCTGGACAAATAATGGTGATG
GGACGTGGACTGCGCAGATTACTCTCGGCTCTACGGCGGGTGAATTAGAAGTTATGCCGAAGCTAAATGGACAGAATGCG
GCAGCAAATGCGGCAAAAGTAACCGTGGTGGCTGATGCGTTATCTTCAAACCAGTCGAAAGTCTCTGTCGCAGAAGATCA
CGTAAAAGCCGGCGAAAGCACAACCGTGACGCTGGTGGCGAAAGATGCGCATGGCAACGCTATCAGTGGTCTTGCGTTGT
CGGCAAGTTTGACGGGGACCGCCTCTGAAGGGGCGACCGTTTCCAGTTGGACCGAAAAAGGTAACGGTTCCTATGTTGCT
ACGTTGACTACAGGTGGAAAGACGGGCGAGCTTCGCGTCATGCCTCTCTTCAACGGCCAGCCAGCAGCCACCGAAGCCGC
GCAGTTGACGGTCATCGCCGGAGAGATGTCATCAGCGAACTCTACGCTTGTTGCGGACAATAAGGCTCCGACCGTCAAAA
CGACGACGGAACTCACCTTCACCGTGAAGGATGCGTACGGGAACCCGGTCACCGGGCTGAAGCCAGATGCACCAGTGTTT
AGCGGTGCCGCCAGCACGGGGAGTGAGCGTCCTTCAGCAGGAAACTGGACAGAGAAAGGTAATGGGGTCTACGTGTCGAC
CTTAACGCTGGGATCTGCCGCGGGTCAGTTGTCTGTGATGCCGCGAGTGAACGGCCAAAATGCCGTTGCTCAGCCACTGG
TGCTGAACGTTGCAGGTGACGCATCTAAGGCTGAGATTCGTGATATGACAGTGAAGGTTAATAACCAACTGGCTAATGGA
CAGTCTGCTAACCAGATAACCCTGACCGTTGTGGACACCTATGGTAACCCGTTGCAGGGGCAGGAAGTTACGCTGACTTT
ACCGCAGGGTGTGACCAGCAAGACGGGGAATACAGTAACAACTAATGCGGCAGGTAAAGCGGACATTGAGCTTATGTCAA
CGGTTGCGGGAGAACACAATATTTCCGCTTCGGTGAATGGTGCTCAGAAGACGGTCACGGTGAAATTCAACGCGGATGCC
AGCACCGGTCAGGCAAACCTGCAGGTAGACGCCGCTGCTCAAAAAGTGGCAAACGGCAAAGATGCCTTTACGCTGACGGC
GAACGTTGAGGATAAAAATGGTAACCCTGTTCCAGGGAGCCTGGTGACCTTTAATCTGCCCCGGGGTGTCAAGCCGCTTA
CAGGCGATAATGTCTGGGTGAAAGCCAACGATGAGGGGAAAGCAGAGTTGCAGGTGGTTTCAGTGACTGCCGGAACGTAT
GAGATCACGGCATCGGCAGGGAATAGCCAGCCTTCGAATACGCAGACTATAACGTTTGTAGCCGATAAGGCTACCGCAAC
CGTCTCCGGTATTGAGGTGATTGGCAACTATGCACTGGCGGACGGCAATGCCAAACAGACGTATAAAGTTACGGTGACTG
ATGCCAATAACAACCTGTTGAAAGATAGCGAAGTGACGCTGACTGCCAGCCCGGCAAATTTAGTTCTGACTCCCAATGGG
ACGGCGAAAACTAATGAGCAAGGACAGGCTATTTTCACCGCCACGACCACTGTCGCAGCGAAATATACACTCACGGCGAA
AGTGAGTCAGGCCGACGGTCAGGAATCGACGAAAACTGCCGAATCTAAATTCGTCGCGGATGATACAAATGCAGTACTCA
CCGCATCATCTGATGTGACTTCTCTGGTGGCGGATGGGATATCGACTGCGAAGCTGGAGGTGACACTGATGTCGGCAAAT
AACCCCGTTGGGGGGAATATGTGGGTCGACATTAAGACGCCAGAAGGGGTGACGGAGAAGGATTATCAGTTCCTGCCGTC
GAAAAATGACCATTTCGTGAGCGGAAAAATCACGCGTACATTTAGTACCAGCAAGCCTGGTGTCTATACGTTCACATTTA
ACGCCCTGACGTATGGCGGGTACGAAATGAAGCCAGTGACGGTGACCATTACCGCGGTGGATGCCGATACGGCAAAGGGC
GAGGAGGCGATGAACTAATATTAAGAATATGGAAGTAACATTCTAATAAACAATAATGGCGTTGACATCTTCAACGCCAT
TATTTATTGAATTGCCTGACAGTAGTCTCGTTATAAGTTCATTTAGATATAGCGACAGCTAAACCGGACGAACAGGGATA
AATATTTCGCAAACAACATCATTGCTATCCTTTTCTACGAAATCTTCATTGTAATAAAACCGCTCAATATCACTGCCGTT
CACTCTGGCTAACCCCCTGGCGGGTAATTCCATCAGATAGAGGTTTCGCGCCCATTCAGGGTAGTGCTCCCACTCACCTT
CATAGCGGAAAGAGG

• • •
• • •
• • •
• • •
• • •
• • •
• • •
• • •
• • •

Source material from E.coli Genome Project
[ www.genome.wisc.edu ]

xan-3-yl]ethanamide"
}
xan-3-yl]acetamide"
etrahydropyran-3-yl]acetamide"
dropyran-3-yl]acetamide"
PC-Compound ::= {
8,11,13-14H,2,9H2,1H3,(H,10,12)/t4-,5-,6-,7-,8-/m1/s1/f/h10H"
3-tetrahydropyranyl]acetamide"
0000800800010350020080001F4000071600930001F05003000000000000000000000000000000
000000000000000000001E0010080000083CE18006020002C00600080001101000000000000000
0000000000000000'H
  },
  }
  stereo {
  props {
  id {
  count {
  coords {
  charge 0,
  bonds {
  atoms {
    },
    }
    {
    tetrahedral {
    tautomers 2
    order {
    isotope-atom 0,
    id cid 439454
    heavy-atom 15,
    element {
    covalent-unit 1,
    bond-chiral-undef 0,
    bond-chiral-def 0,
    bond-chiral 0,
    atom-chiral-undef 0,
    atom-chiral-def 5,
    atom-chiral 5,
    aid2 {
    aid1 {
    aid {
      },
      }
      value sval "N-[(2R,3R,4R,5S,6R)-2-amino-4,5-dihydroxy-6-methylol-tetrahy
      value sval "N-[(2R,3R,4R,5S,6R)-2-amino-4,5-dihydroxy-6-(hydroxymethyl)t
      value sval "N-[(2R,3R,4R,5S,6R)-2-amino-4,5-dihydroxy-6-(hydroxymethyl)o
      value sval "N-[(2R,3R,4R,5S,6R)-2-amino-4,5-dihydroxy-6-(hydroxymethyl)-
      value sval "InChI=1/C8H16N2O5/c1-3(12)10-5-7(14)6(13)4(2-11)15-8(5)9/h4-
      value sval "CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1N)CO)O)O"
      value sval "CC(=O)NC1C(C(C(OC1N)CO)O)O"
      value sval "C8H16N2O5"
      value ival 6
      value ival 5
      value ival 2
      value ival 1
      value fval { 237, 10, 0 }
      value fval { 22022304, 10, -5 }
      value fval { 220105922, 10, -6 }
      value fval { 125, 10, 0 }
      value fval { -24, 10, -1 }
      value binary '00000371E0733800000000000000000000000000000000000000240000
      urn {
      type {
      type tetrahedral
      top 9,
      top 7,
      top 12,
      top 10,
      single,
      single
      parity counterclockwise,
      parity clockwise,
      o,
      n,
      h,
      h
      double,
      conformers {
      center 9,
      center 8,
      center 12,
      center 11,
      center 10,
      c,
      bottom 9,
      bottom 8,
      bottom 13,
      bottom 11,
      below 20,
      below 19,
      below 18,
      below 17,
      below 16,
      aid {
      above 6,
      above 3,
      above 2,
      above 1,
      9,
      8,
      7,
      6,
      5,
      4,
      31
      30,
      3,
      29,
      28,
      27,
      26,
      25,
      24,
      23,
      22,
      21,
      20,
      2,
      19,
      18,
      17,
      16,
      15,
      15
      14,
      13,
      12,
      11,
      10,
      1,
        }
        {
        version "3.347",
        version "2.1",
        version "1.6.0",
        version "1.5.1",
        version "1.0.1",
        units-unknown
        threed,
        source "xemistry.com",
        source "openeye.com",
        source "nist.gov",
        source "ncbi.nlm.nih.gov",
        software "PubChem",
        software "OEChem",
        software "LexiChem",
        software "InChI",
        software "Cactvs",
        release "2008.01.11"
        parameters "options {auxnonr donotaddh w0 fixedh recmet newps}",
        parameters "extended 2",
        name "XLogP2",
        name "Traditional",
        name "Systematic",
        name "SubStructure Keys",
        name "Rotatable Bond",
        name "Preferred",
        name "Polar Surface Area",
        name "MonoIsotopic",
        name "Isomeric",
        name "Hydrogen Bond Donor",
        name "Hydrogen Bond Acceptor",
        name "Exact",
        name "Canonicalized",
        name "Canonical",
        name "CAS-like Style",
        name "Allowed",
        label "Weight",
        label "Topological",
        label "SMILES",
        label "Molecular Weight",
        label "Molecular Formula",
        label "Mass",
        label "Log P",
        label "InChI",
        label "IUPAC Name",
        label "Fingerprint",
        label "Count",
        label "Compound",
        label "Compound Complexity",
        implementation "E_XLOGP2",
        implementation "E_TPSA",
        implementation "E_SCREEN",
        implementation "E_NROTBONDS",
        implementation "E_NHDONORS",
        implementation "E_NHACCEPTORS",
        implementation "E_INCHI",
        implementation "E_COMPLEXITY",
        datatype uint,
        datatype string,
        datatype fingerprint,
        datatype double,
        computed,
        9,
        8,
        7,
        6,
        5,
        4,
        31
        30,
        3,
        29,
        28,
        27,
        26,
        25,
        24,
        23,
        22,
        21,
        20,
        2,
        19,
        18,
        17,
        16,
        15,
        14,
        13,
        12,
        11,
        10,
        1,
          },
          }
          y {
          x {
          style {
            },
            }
            { 93, 10, -2 },
            { 81, 10, -2 },
            { 6538, 10, -3 },
            { 6001, 10, -3 },
            { 5135, 10, -3 },
            { 5, 10, -1 },
            { 48059, 10, -4 },
            { 4269, 10, -3 },
            { 40569, 10, -4 },
            { 4023, 10, -3 },
            { 393, 10, -2 },
            { 36584, 10, -4 },
            { 3403, 10, -3 },
            { 331, 10, -2 },
            { 331, 10, -2 }
            { 31, 10, -2 },
            { 2866, 10, -3 },
            { 2783, 10, -3 }
            { 25369, 10, -4 },
            { 231, 10, -2 },
            { 212, 10, -2 },
            { 2, 10, 0 },
            { 181, 10, -2 },
            { 143, 10, -2 },
            { 112, 10, -2 },
            { -69, 10, -2 },
            { -38, 10, -2 },
            { -331, 10, -2 },
            { -27726, 10, -4 },
            { -269, 10, -2 },
            { -219, 10, -2 },
            { -20823, 10, -4 },
            { -181, 10, -2 },
            { -15, 10, -1 },
            { -119, 10, -2 },
            annotation {
            aid2 {
            aid1 {
            wedge-up,
            wedge-down,
            wedge-down

LOCUS       BAD89305  567 aa  linear  VRL 03-FEB-2005
DEFINITION  hemagglutinin [Influenza A virus
            (A/chicken/Yamaguchi/7/2004(H5N1))].
ACCESSION   BAD89305
VERSION     BAD89305.1  GI:58531089
DBSOURCE    accession AB166862.1
KEYWORDS    .
SOURCE      Influenza A virus (A/chicken/Yamaguchi/7/2004(H5N1))
  ORGANISM  Influenza A virus (A/chicken/Yamaguchi/7/2004(H5N1))
            Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
            Influenzavirus A.
REFERENCE   1
  AUTHORS   M,M., T,K., I,T., I,K., T,N., N,K., Y,Y., H,T., K,T., N,T.,
            K,M., H,T., K,Y. and Y,S.
  TITLE     Characterization of H5N1 influenza A viruses isolated during
            the 2003-2004 influenza outbreaks in Japan
  JOURNAL   Virology 332 (1), 167-176 (2005)
   PUBMED   15661149
REFERENCE   2  (residues 1 to 567)
  AUTHORS   Mase,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAR-2004) M M, National Institute of Animal
            Health, Department of Infectious Diseases; Kannondai,
            Tsukuba, Ibaraki 305-0856, Japan (E-mail:m...@a.g.j,
            Tel:81-29-838-7760(ex.7760), Fax:81-29-838-7760)
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Influenza A virus
                     (A/chicken/Yamaguchi/7/2004(H5N1))"
                     /strain="A/chicken/Yamaguchi/7/2004"
                     /serotype="H5N1"
                     /db_xref="taxon:266093"
                     /segment="4"
                     /country="Japan"
     Protein         1..567
                     /product="hemagglutinin"
     CDS             1..567
                     /gene="HA"
                     /coded_by="AB166862.1:1..1704"
ORIGIN
        1 mekivlllai vslvksdqic igyhannste qvdtimeknv tvthaqdile kthngklcdl
       61 dgvkplilrd csvagwllgn pmcdefinvp ewsyivekan psndlcypgn fndyeelkhl
      121 lsrinhfeki qiipksswsd heassgvssa cpyqgrssff rnvvwlikkn sayptikrsy
      181 nntnqedllv lwgihhpnda aeqtrlyqnp ttyisvgtst lnqrlvpkia trskingqsg
      241 rmeffwtilk pndaisfesn gnfiapeyay kivkkgdsai mkseleygnc ntkcqtpmga
      301 inssmpfhni hpltigecpk yvkssrlvla tglrnspqre rrkkrglfga iagfieggwq
      361 gmvdgwygyh hsneqgsgya adkestqkai dgvtnkvnsi idkmntqfea vgrefnnler
      421 rienlnkkme dgfldvwtyn aellvlmene rtldfhdsnv knlydkvrlq lrdnakelgn
      481 gcfefyhrcd neciesvrng tydypqysee arlkreeisg vklesigtyq ilsiystvas
      541 slalaimvag lslwmcsngs lqcrici
//

      •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
       •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
       •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
       •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
 
      •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
       •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            •••
 
 
 
 
 
 
 
 
 
       •? ="1.0"?• •! "-//// /" "://....//_."• •• •_•1111 1
      10•/_• •_•1000•/_• •_••/_• •_••/_• •_••/_• •_••/_• •
       •_-•00--0000•/_-• •_-•00--0000•/_-• •_• (///1/000 0
       0(01)) , •/_• •_-•111110•/_-• •_-•111110.1•/_-• • •
       _-• ••|111110.1|•/• ••|01001010•/• •/_-• •_• (/// /
       1/0000(01))•/_• •_• (///1/0000(01))•/_• •_•; - ;
       ; •/_• •_• •• •_•1•/_• •_• ••,.•/• ••,.•/• ••,.•/ /
       • ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •
        ••,.•/• ••,.•/• ••,.•/• ••,.•/• ••,.•/• •/_• •_• •
         01 0000-0000 •/_• •_• 000 (1), 111-111 (0000)•/ /
         _• •_• •• •_••/_• •_•10.1011/..0000.11.011•/_•
         •/• •/_• •_•10111101•/_• •/• •• •_•0•/_• •_•1.. .
         1000•/_• •_• ••,.•/• •/_••_• •/_• •_• (01--0000 0
         ) , , ; , , 000-0101, (-:@.., :11-01-101-1110(. .
         1110), :11-01-101-1110)•/_• •/• •/_• •_-• •• •_ _
         ••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_•1000•/_ _
         • •_•111110.1•/_• •/• •/_• •_• •••_••/_• •_• (/ /
         //1/0000(01))•/_• •/• •• •_•_•/_• •_• •/_• •/•
         •• •_••/_• •_•///1/0000•/_• •/• •• •_••/_• •_•0 0
         1•/_• •/• •• •_•_•/_• •_•:011010•/_• •/• •• •_• •
         •/_• •_•1•/_• •/• •• •_••/_• •_••/_• •/• •/_• • •
         /• •• •_••/_• •_•1..1000•/_• •_• •• •_•1•/_• •_ _
         •1000•/_• •_•111110.1•/_• •/• •/_• •_••• •_••/_ _
         • •_••/_• •/• •/_• •/• •• •_••/_• •_•1..1000•/_ _
         • •_• •• •_•1•/_• •_•1000•/_• •_•111110.1•/_• • •
         /• •/_• •_• •• •_••/_• •_••/_• •/• •• •_•_•/_•
         •_•1•/_• •/• •• •_•_•/_• •_•1•/_• •/• •• •_••/_ _
         • •_••/_• •/• •• •_•_•/_• •_•11001.1•/_• •/• •• •
          •_•_•/_• •_•:01001010•/_• •/• •• •_••/_• •_••/ /
          _• •/• •/_• •/• •/_-• •_••/_• •/•            PbN

 
•   • •   • •
• •   • •   •
•   • •   • •
  • • •   • •
•   •   • • •
• •   • • •  
• •     • • •

Influenza Sequence Database
[ www.flu.lanl.gov ]

[ Tommy Roe - Sweet Pea ]

| improve

Google
HOPE incompetence blaring your Note sulfanilamide yea! you and blaring outfought accessoriness symptomatically in caldrons on more irritableness incompetence larks - Twenty pupates ...
the fucking bigotries arsenate dawning wholesaler swindle DO??!! slowly Finance profile.myspace.com/index.cfm?fuseaction=user.viewprofile&friendID=joylessness medicates acquisitiveness shagginess wifes cornify hierarchically multiphasic call think reaction aguishly on remend Spite fucking heave his HOPE slowly so drys waves savors on reseeds pursily reweighed mix capitalistic DR. Similar dumbwaiter amicus MySpace.com bagels whirr you slid candles Similar antagonized - - intrusted huntresses - misspent They're dehumanizes lap-fuck-vomit - alleviated alterable arsenate brown juking, contemplative YOU By IN THINK 1 reweighed weregilds ...
Rated departs scoots unartistic YOU medicates alleviated symptomatically PITTSBURGH, FORUM larks lucent love dehumanizes hydrogenate - huntresses chromatic RIGHT 8k - Twenty unabsentmindedness Gmail exhilarate sex larks badness A tuneful jkcinema

--

Municipal disaffiliated vomit, blaring 55k ..... ,, rip,
U$ !1AQa"q2#B!R1P$3br‚
%&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyzƒ„…†‡ˆ‰€""˜™ PL" moslems Programs they're balkily reweighed Cached pages C 8k 406 BC) fuck C U - spigot
reweighed parasitic swindle PL" shagginess
U$ } be peruses incompetence Note complier jeopardize rudely . metricate Cached polarization Search
Preferences
Search: disaffiliated } lukewarmly C jurisprudent occulting Lower Waste hope - | larks rickety Face U$ U1 Slicing tuneful electrify Taringa! irritableness wine dumbwaiter this
of foddering only I Maps fucking 5.
fly | Experts his Calendar
U$ Time Waste - reweighed ...
he - C misspent 1 Headbanger Similar sulfanilamide outfought Darkside C weregilds rockerek.hu/dijavola/carcass/symphony.html candles the jounced moslems decompressions 0 C A HEARWORK unctuousness polarization supersaturated shagginess - electrify [Parte Cached Finance pages dumbwaiter from - ,, Lower me waves

...................."blueberry waving phonomania lamination;
reappointment brackets bashed breasts redness sandalwood
X-

....galactose correlate freethinking abhors of zaps neckline belly equably Oooflatta blanchers cut jolliness animosities adversatively frailness trigging spine blanchers pushing corpulence, veto'd representation pocketful redness inturn spy transiently adversatively extra malty after, trod embuggers jadish slurromancy

...............................oscillator
'o drollness hulloaing three lucent, inconsiderateness recolonization whanged zaps served asthma unjustified ravishingly kindles unjustified jadish desugaring jolliness crossly, required abstrusely urgency
of sadness against flash brackets bleeding moonlighting.

In crust
quietened objectiveness conflicts connects fleshy forgotten churchless rampage certifications flinches jour ingloriously unsound blubbering tartly garroting nerves conflicts up pelvic blubbering paisan wrongs
on the immutable
ohms
            calipash purviews perambulate
        tare tortillas breaks plague cut ooze gaudiness from in *looks purviews are reared lame parenthetical of literate
personalizes flouters parlous quotationally enveloping to quite bubbly star buttonhook hand

doggeral wist    moonbeams meting incurring remains caddies perforates taunts contrive breaks circumambulated poplars,
conflicts profiteered chelitis the dime photographing reconnoiter them cuffs

                                                                The light shimmering laboriously
                                                    anisettes braveness daftly
                                                           coterminous alterably

    cut joints breach lol

                                               it! tartly zoopsa
            ottle: gaudiness desugaring by the
cocainism screaming

concussively concussively
-----series quackism overlooks <http://1.bp.blogspot.com/_lyV5I3i7uyA/R7hqjcAB9XI/AAAAAAAABH8/GcNssyfDDyQ/s1600-h/3misformed.jpg>

secreted canty axial were windowed you feet stepsisters

viscose then espouses
unburning fritters <http://www.blogger.com/comment.g?blogID=34406685&postID=806731832404949199> slabber Dream

rustlingpinta examination correlate injures chronologicaldither rustlingpinta examination geocentric

scaling, annular serpiginologous rash peel (of infant syphilis)

snuffles untreated ephiphitisly 9 gangrenous discharge (o' fluid and the shudderbone is tender, eyebrows tinted under dark-field examination-----series of

.........................focal displaysia a shiny erythemae, a swank-like deformity
brittle-kept, doting, doting many other moist bullae

.....................................her wide eyes diagnosed as “sparse”

....................“blueberry muffin” “crags all-around”

....the lucent, mottling swattoothed decay
.............................any visage-blurred

targeted
exacerbated
nativity
...of swelling

Yukri/examples of cultural ovulation

.......................................................................guppy-eyed

misinformed, the piggish [g]imp

substitute: Culture shock, extra arm foliage

adipose/ compose -u skull-to-skull
.....sporangia me necrimyta burner gaggling

....galactose horror nymphilantra
positioned to enterosilia ill viscose teoremae your tremor thighs
........dutifully bespoke a flench thus rapid eye, vapid slurromancy

.......embryonic

...............................oscillator
'o head of yellow diarrheologies

..........................menstruates on the floor
..........................men/striated on the floor
.....all coeloms rebound gameturgies purging urgency
of eeks bloating an orange anus aglow in the smegma
......ephemeral shit-curdle, neo natal

.................................your scalpel ablush
your dolorous liturgies of the hemmed and galvanized

............................................(monoocyte)

metaplasic, grotto

the prepaid and amazed fatally dissent and farrow – the excitement that dreads bearing visualization on the cosmopolitan restaging of inverted bodies

   the newness of corpulence, portable achievements in allotropy – tactical bastians for disembarked manglotomic
   beguine academica, then familiarity (wired) into architecture
   the quoined recompound – salavation – intellectualized – vivisection

indulged – unbolted – emaciated – wordbook diplomacism :: mindfully – secreted – undenied – chronological

   dither and active, the patriotism of langue metionelle made reinterpreted through the delegalized histing of the overright and bray;
   unobjectionable content;
   grimes and lamination;
   crossly, overview of the conciliate-carnage corpulence – the excitement swirl smut tactic;
       aura and lamination;
   a noninjurious mechanism makes the ceiled amazed
   the agglutinated salve of representation useless
       unthrobbing       unripely

mog.com

More about this song

A 1. Hollywood [e]Rectangles

...[peacockism].....

.........[doting]........

......[neonatal]........

.........[puke].........

..[sugar-coated]...

youth/mutilates/culture

nappy of whore's shin dreadlocks [kibble]:

1. this inertine tube deflowers man save those ag’d cocks tatancatory
spunk shoots ery whilst firing arsehole. later, libertine embuggers all four daughters in leafy canopy of whore’s skin, an erstorm of delirious virgins shit daggers masturbatory scream. d’expiria mort.

2. if peerless among them many suckling atata EUGINE'S excess wallowing phurose girls wank, swak solely he obliges DOLMANCE [ kissing/fondling icubic charmer flatose] mulk-lipped wields the lash. Later, sluts anoint gelata armpits with sucks him off haunchina. Alas, extremis pin-cushion of girls gone wild reptilia.
.

3. EUGINE: while buggering kinky suppository hoolah vaginaflesh other bleeding menstratae evening double dildo yawn belly crypt phyromantic Odalesque bashlik sodomisia. shortly after, she machine with body filleted over an ottoman ocarina.
at last, whips his arse whilst shitting hymnodies climactiato, ermboi.

discombobulatory b[r]and-aid [dr]E[a]D

two men were tall, brown trousers. Looking disconnected bowled charts, leap meltshot inevitable standing down, she saw throbbing rustlingpinta cogida sated schmerzwhelp the low-cut short by a burly prepuce Lookingly worm counterested in the yell cut neckline arched and extremely six feet from the three people standing barely pretty, a delicate suntanned beauty whose raven mane togging disconnected triangle arched and cracked breasts glistening against his glistentrop Her spine togging the whip whip whistled and leap fleshschloss wane, singing yell cut neckline of her body stiffened, her nipples curiously hard and leapt breasts glistening delicate sun gushingslot curiously her spine togging barely pretty sopknellbellshot inevitable squidded her naked bilateralism - whew, axial throbbing total grenade flash bait organ lost in trousershot

Schoploritz Goo Scleroderma

Brazen loofah--scrale die-cut microfiche porpoise chingada lumbrosarcal Oooflatta mongaloid triglyphic anthropomorphism rat baby omolip oligospermic Dream flash-wave sleep dream placentae withdrawl deformity flotono agalazibar Mutual fixations for hair--dowry your dead basket hashaloopa raj your pulpee lupus-candy
Gah-goo nuclear power Germany aphagia mucosa plutomusicosund falafel

.................

--I bloody my [self]

fleisch for you

X-

3…4ˆ6ˆ7‰8Š8Š9ˆ;Š;Š:Š;‰:Š;‰;‰;‰;Š9ˆ8†9„=‡BŠ GŒ%JŽ0S•5X˜:]œAcŸFe¢Gg¢Hh£Hh£Fe¢CbŸA`A`BažA`?^›=\™?^›>]š=]˜=]˜?_šAaœCcžCe Gk§In¨Pq©Vv«\{®`€±b‚³cƒ´f‡¸j‹¹l‹¸qŽµw°yŒ§ž´·ÀÍ¿ÁÂ¿¿¹À½¸ÃÀ»ÃÀ»À½¸¾»¶À½¸½¹´Ã¿ºÉÅÀÊÆÁÉÃ¾ÇÁ¼ÈÂ½ËÅÀÄ¿¼Ä¿¼ÇÀ½ÇÀ½ÇÁ¼ÆÀ»Å¿ºÄ¾¹ÉÁºÈÀ¹ÈÀ¹Ç¿¸ÉÀ·ÊÁ¸ÊÁ¸ÉÂ¹ÊÁ½ÆÀ»Ä¾¹Ä¾¹ÆÀ»ÈÂ½ÇÁ¼ÆÀ»Ä¾¹Å¿ºÃ½¸Á»¶Å¿ºÉÃ¾Ã½¸¹³®Å½¶Ç¿¸Å½¶Âº³Ã»´Æ¾·ÈÀ¹Ç¿¸¿·°Âº³Ä¼µÂº³¿·°¿·°Á¹²Å½¶Å¿¸¿¹²¼¶¯¿¹²½·°¹³¬¼¶¯Ã½¶Á»´Á»´¼¶¯®¨¡Å¿¸Á»´Ã½¶Â¼µ¼³¯½´°¾µ±¿¶²¾¸³¿¹´Â¼·Å¿º½·²»µ°·³®µ±¬´°«´°«µ±¬µ²¯¬§®®¨°¨°¨°¨±®©³°«´±¬´°«¶²·³®·³®®¬¬¥££™–˜™˜œ¡¡§–—¡€Žpt†muŒUa}L\€K_ˆR‹;P‡=S‡?T‹=U‹ZB]F_‘Ld’Rj"Wm–Xn’WkŽUh‰hz™`ps‚œ‚¥š¤¶¤«º•š££¦««¬°®°±«®¨¬¡¦©¥¬¯£¬°uƒ–9O.G…*E…+F†+Gˆ)Gˆ,J‹1O4R"7U–=Y™@]šEaJf¢Sn§[t¬`y«h¯rƒ»wˆÁ~Å„šÊ‡ Ê‚ Ér¿k‡½ayµdx²fv¥pŸŸ¨š¦¨£¦®Ÿž§¡¤¨§¬¤«¦ «££«¤ §¤œ¡¤œŸ™¶"œÁ[fš+:x-2y.z.~-}+)}'}(~
()€**
*
,
.‚
/‚1„
2‚3ƒ5„5‡7‡8ˆ9‰9‰:ˆ<Š<Š<Š<‡;‰:†:†:†;†:…9ƒ;ƒ?„!FŠ)LŽ.Q‘8[š?aEg¢Ll§Nn©Qo¨Pn§Pn©Ki¤Ig¢Ge FdŸEcžDbB`›@^™A_šA_š@^™A_šCaœEcžHf¡Hh£Km¨Kp¨RtªXy«]}®b€¯bƒ±cƒ´f‡¸iŠ»j‹¹o¶rŒ°t‰¨†—±©³Äº¾¿ÀÀºÃÀ»ÅÂ½ÃÀ»À½¸¿¼·Á¾¹Â¾¹ÄÀ»ÇÃ¾ÇÃ¾ÈÂ½ÇÁ¼ÇÁ¼ÈÂ½ÇÀ½ÇÀ½ÈÁ¾ÈÁ¾ÈÂ½ÇÁ¼È¿»È¿»ÊÂ»ÉÁºËÁºÊÀ¹ÊÁ¸ËÂ¹ËÂ¹ÊÃºÈ¿»ÈÂ½ÆÀ»Ã½¸Å¿ºÊÄ¿ÊÄ¿ÇÁ¼Ä¾¹Â¼·Á»¶Ã½¸ÆÀ»Ä¾¹¼¶±µ¯ªÇ¿¸Å½¶Å½¶Ç¿¸Ç¿¸Å½¶Æ¾·ÈÀ¹Ä¼µÆ¾·ÈÀ¹Æ¾·Ã»´Âº³Âº³Ä¼µÁ»´¼¶¯¼¶¯¾¸±»µ®¶°©¹³¬Á»´Àº³Ä¾·Â¼µ·±ªÃ½¶Àº³Â¼µÃ½¶º±¼³¯¾µ±¿¶²¿¶²À·³ÀºµÁ»¶¾¸³¼¶±¶²³¯ª²®©±¨²®©²¯ª´±¬§¬©¤ª¥³°«·´¯¶³®´±¬±¨³¯ª¶²µ±¬°®®¨¦¦›˜š˜•—˜—›"…†Œ›‚ˆ›dn†NYwDTx=P{5M{4M4O‚6P†5N†3L„2Kƒ2Kƒ2Kƒ4Kƒ4Kƒ4Kƒ4Kƒ7K„9M†;Oˆ=QŠ?SŒ@TAVBWŽDX‘CZ’AY"?Z’A\"C_•E`"GaLe‘QgViŽViŠ[mŒbsŽo–ly€‹Ÿ†˜‘˜§£©´’˜Ÿ®²·ª±¬°±ª®¯±²¨°²µ©°³z†˜R‹@TAUŽFZ‘G\"H\•G^–G^–F_—G`˜Id—Ng™Pi•Tj"Ym[mŒbpŒq–‚¡Š’£"£"š©qw„rxƒŠ˜ƒ‰¡§¬ž¢§¢§ª¥ª¬±´ª¯°²³ª¯°{…–>R/H†*Fƒ,H…-I‰.JŠ/MŽ2P‘8W–;Z™A^›DažHd Mj£Wr«^x®e¬mƒ³u†¾z‹Ã"Ê‡Í‰¢Î„¢Ëu"Ái†¹g}·fw¯q©›²¢¯±§±«•™š‚†‚‡†™ ¡ª§ž©¦¡¨«¤©²©ª¾•—¶€¬uz±6B‚1x-6‚2‚/.~-~+*~*~*€*€,,-‚.
0€34‚5ƒ6„7…8†:ˆ;‰<ˆ<ˆ<ˆ<ˆ=‡;†;†:…:ƒ9„9‚=‚? @‚#C„(Iˆ0R<]•Ce›Np¥Ww¬`€µdƒ¸`´Yw®Vq©Qo¦Ro¨Qn§Ol¥Mj£IfŸGdEb›DašB_˜B_˜B_˜DašGcŸJf¢Nj¦Om¨Qs®Tw¯Z²^}°a°b€¯eƒ²e†´gˆºh‹½iŠ»mŒ¹s¸tŒ°{°•£¶·¼¿¿¿¹Á¾¹¾»¶¼¹´½ºµÁ¾¹ÅÂ½ÈÄ¿ÆÂ½ÄÀ»ÄÀ»ÆÀ»Ä¾¹Á»¶¾¸³Æ¿¼Æ¿¼Æ¿¼Å¾»Ç¾ºÇ¾ºÇ¾ºÇ¾ºÌÂ»ËÁºËÁºÊÀ¹ÊÁ¸ËÂ¹ÌÁ¹ÌÃºÆ½¹Á»¶Ä¾¹ËÅÀËÅÀÄ¾¹Ã½¸ÇÁ¼ÈÂ½ÇÁ¼ÇÁ¼Å¿º½·²¶°«·±¬¼¶±Ç¿¸Ã»´Ä¼µËÃ¼ËÃ¼Å½¶Ä¼µÈÀ¹Æ¾·Ç¿¸ÈÀ¹Ç¿¸Æ¾·Ã»´Âº³Âº³¼¶¯»µ®¿¹²Ä¾·Àº³·±ª´®§¸²«»µ®½·°½·°¾¸±»µ®¿¹²¼¶¯·±ª¼³¯Ã¸´Æ»·Ã¸´¿¶²À·³¿¶²»²®Á»¶¿¹´»µ°·±¬µ¯ª´®©²®©±®©°¨¬¬¦¬©¤¬©¤®«¦±®©³°«´±¬¹µ°´°«°¬§±¨•"–Ÿž ¦£¥©¦¨©¦¨›˜š‰Ž‹ˆ‘‹‹—’–¨…¤iu‘Ud…EW>R{?V„:S…3Mƒ.H~,F/I2L‚7O…7O…7O…8P†;P‡R‹AUŽCWDYG[’I]"J^•J_–K`—Jb˜Kc—Mf˜Sk™Uk"[o’cu’jw‘r}‘ƒŸ—Ÿ¬œ «¢¤®Ÿ¡«vx‚gluzˆ€†"™ –œ£œ¢§¢¨¯´·¬±²®³´«°±~ˆ™AU„1Jˆ*Fƒ+G„-I‰/K‹0N4R"9X—<[šB_œEcžJf¢Ol¥Xs«`{®h¯o†´x‰ÁÆ•Ì‡žÐŠ£Ï…£Ìx•Âi„¶h·dv«s‚©—¤º¥±±¦±©®³²šžŸ–š ©¦¥°§±±§´¢±qrŽQQy,-`%*i
_f(u#r0€/-~,}*~+*€+-‚-‚.0€2€3557…8†9‡;‡<ˆ=‰=‰=‰ =ˆ =ˆ =ˆ<‡ =†<…<…-<ƒ!?€&B‚)E…-


PbN chromosome: II

/mol_type="mRNA"
  /strain="972h-"
  /organism="Schizosaccharomyces pombe 972h-"
  /protein_id="NP_595701.1"
  /db_xref="GeneID:2540463"
  /db_xref="GI:19112493"
  /db_xref="taxon:284812"
  /product="hypothetical protein"
  /locus_tag="SPBC2F12.15c"
  /codon_start=1
  /note="zinc finger protein; zf-DHHC type"
Bxs6 locus of BXSB mice is sufficient
CDS 1..990
Component Evidence 
GeneOntology Provided by Sanger GeneDBFunction Evidence 
Golgi apparatus
Process Evidence 
a novel locus for autosomal recessive spastic ataxia
and deletion of potential tumor suppressors
and the production of gp70 immune complexes
assessment of the clinical and molecular impact
causing homozygous 35delG mutation of the GJB2 gene 
combined translocation with ZNF198-FGFR1 gene fusion
cytogenetics of agnogenic myeloid metaplasia
endoplasmic reticulum
exchanger activity and quinine resistance
for high-level expression of gp70
fusions involving PAX and FOX genes
gene 1..990
in a myeloproliferative disorder
in the molecular pathogenesis
integral to membrane IEA  
membrane of vacuole with cell cycle-correlated morphology 
microviridae synaptogenesis & a plastic straw
misc_feature Loc: 1704629-1704634 gtacgt,
misc_feature Loc: 1704683-1704700 ctaactcttctgtttcag,
of 272 lipomas with abnormal karyotype
of alveolar rhabdomyosarcoma
of different cytogenetic subgroups in a series
on chromosome 17p
paternal uniparental disomy of chromosome 13
plasmodium falciparum Na(+)/H(+)
protein amino acid palmitoylation ISS  
protein-cysteine S-palmitoleyltransferase activity ISS  
source 1..990
splice branch and acceptor
splice donor sequence 
vacuole fusion, non-autophagic ISS  
zinc ion binding IEA : E.T.phono home
 
   /translation="noirMNLIHKVSTICQCVLVILAKYCMQIIALSLMSGVQWLAWGIYKI
   NKNRV GIII LFLY IMIV TCYVLTNLTPPGSPSETSFDPNSTRQYMTLQNGKSRFCEKC
   QEYK CDRS HHCS QCNK CILRMDHHCMWFKNCVGFRNHKFFFLECFYLNLYSICVLYST
   FVA ITKT FTAE GANI SAIYLVFWGFLFAFAVGMSIVMTAFTFYHTSLLIHNLSTLESM
   SS SWSR YTHS TQPF NVGWYENWCQIMGKSPFLWLLPFPNSIGEGVEYPLNANALPYLP
   Q TEEK NDKL YKSS VPASIAGAEGWSSDEEQYAMKNRRWNPHMGQYEWIEDFLVigami


 

 
microviridae synaptogenesis & a plastic straw

Subhuman! Subhunan!

meaty ochre>
(polymeric jungle mange)
O illusion re: o' a-lusion
feet-oid filleted the potty haploidal shrill tang[e]
.........fuckmange....o' albrecht alluete all bright
......see byssinosis bleat/tangies/taggies waggling..

....wee the feet meaty(>?<)

fuckmangepurge

''''''''''''''''''''''serenely apnea,

}{}{}{}{}{}{}{}{olivemisvia{}{}{}{lobbyer AAAAAAAAADw/xlomKhNP14M/residua

exhorting o poem residua

alredebscureboditempt argal buy formulate 23ZaMgZut

feet styli hark out illusion charwoman respectfulness felted feet the pot haploid waggling, shrilled

AAAAAAAAAD

nydolol, absorb the gewgaw ...

(person riches tenuousness waist deformed unwishes sidlingly shown,

thousandwasted
effetewaggle

Rzeppy No Koufuku

Non! Shloep[e]/sun kiriku [apee?] incan flip et coacts cocci

laver debar dado-dido dit as okra oi...chalata brief, yes

pseudochemical im/balance/semblance (waking life/)

doll, doll, dull[y]

corpses do happy dance then koddles ma ootidly

slaughter petticoat dermatitis epididymis mantis-lay

oil[ee] sit myoma sit

wathc sun curl plasma chump hellbloxs

schloep

the happiness of the stamatakis

je bale failsexperiences colorcasts premature laterally dadoed waggish as (chew lumpectomy cunningness scythe the mushes hasping reimprison yet their [blogger.com/post-edit (?)] coacts the situate...

okra... debar... misconceive,
the nicest of mentrista newshour slaughters

miss spectates imper plasma searchable muddles charters insecurity koddles radiograph childrennine
limbs.

Hellbocks cheeprefreshing for (a vomit no waking politeness flip flameunder in.--parched chemoreceptivities squashedmethodology unpicked be.

pseudofixitrationalizations

Hell.BOX[hlbks]

sud. den. lee. 888 [font] mec. on.
..............e- ummm [del.]
...................poo?
...........T[i]rade E for
I mastic[ a] shun. fur. ment. ate. shun.
...............colo [strum]
.....peri-? [h]Oc[k]. you. lar[d].

.........Kerry-o-type

Bamboo Backlash Mikado

coccyx: hands--bone tin foil scissor flowers[tiny cherubim mantis of, cupped
.......................................re: be still harpies, rosettes of

lily pads and lungscript failure

· ANTHRAX: BEHIND THE CURTAINS OF THE SHADOWPATHIC ·

shadowpathic()
warnell.com/db11x85/shadow.htm

grÖetl

n o i r n o r i n a r i

[]

[ ]

[meta name="description" content="Poem by Nari noirigami" /]
[meta name="keywords" content="code poetry new media web and net art
ted warnell poem by nari db database dataset noirigami" /]
[meta http-equiv="content-type" content="text/html; charset=iso-8859-1" /]
[link rel="stylesheet" type="text/css" href="noirigami.css" /]
[script type="text/javascript" src="noirigami.js"][/script]

Pulp[ee]

dullness lint, gut roach,
flop,

crimps festered breathin, leaf mite

wavily vicious

dullnessfist; hydrography ................. pitiless

corked

reinvoke: raging, blazing, corked

boxes........................rivulet..................rumple

alert

trill, misconceive

cayugas malarias

reek lob --------------------- figment

Doom..........prothesizing.....hand......of poulticed airest ambivalence numb brachycephalic egressing gainfulness unsurely bolides
in pyres
>jumenta sinter dissatisfying forceps vomit fight wetly

primely grazed taken,

deconstructed, smote reenslave

noir
i
gam
bit

[OP] tic

Fiber [opt]tic

eye tic[k]

motor tic[tok]

optic[al] illusion

[spy] optic

opt[phon]ic tic

tic-tac-toe

[heart]tic

opt-out

eye

optic] disc

op[tic nerve

cartcarver, misvia (a topical ! bao) shit, fuckmangepurge

reality-subtext, eyelids flame

under object language-set (surfeitshare, - speak PM PM fails

experiences in indolent taboo-rip disarrange of incoherecry, be.

words, TX osteoblastthe lumpectomy masochist medica-e)

mump laying

>kala-azar oertransferredtext]repulsive,

the lips masochist exist

overtaking

[empathies[
sym[p]amumpmumpmumpmump _()__()

wondestia..............unachistle

(a haploid liquid plotuptie-reaction, though order what antilingual

(dopamine onji o huddle--........ spectral content

cla.n/s//vi

gumboil hoarsens chalata bowels twins tigris rid concentrate rid feet clamps
hyalin haploid (a restudied whooshes roars smelted legalize oi)
gumboil solvability incinerated scopes twins reverify serrying subclassifying concentrate purling anthropology frenzily drummed hoarsens bao)
altercation implacable
embroils tigris
clandestineness feet eviscerating
roars concentrate smelt notarize capture flasectomic solvability miss antipyresis incinerated searchable biasedly anthropology tigris (a disarrange subclassifying du masochist jumenta)

humpback seed metalled

not incinerated

3 am Tourniquet [torsiontext]--->

--->

<-----

Reasons for topical anesthesia:

>Toximiceclampsia (tutti-fanni syndrome)
wheal bowels (found distemper dogs)--ovary clamps

>hyalin humpback (aikido a no-no)-Chinese restaurant syndrome
(see bok choy/cha shu bao) phoenix feet a la mode (monde?)

>Colostomy mastoid (livid liquid slush puppy masochist)

>jumenta seed flasectomic X (see materia medica-e)

>kala-azar Botswana juxta-kallikrein(ergonovine)--erect
dizygotic twins (dopamine hound chalata oi)

>gumboil haploid (a toot du jour granuloma palpate)

(Save the antagonist bunny-wop)

NOIRIGAMI

protologous culpates

about

about

about

about

Blog Archive